Paralogue Annotation for ANK2 residue 1110

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1110
Reference Amino Acid: I - Isoleucine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 1110

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
ANK1I1055TSpherocytosisHigh9 11102985

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in ANK2.



ANK2TEDELNEILNGMDEVLDSPEDLEKKRICRI>I<TRDFPQYFAVVSRIKQDSNLIGPEGGVLSS1140
ANK1GESYLDQILNGMDEELGSLEELEKKRVCRI>I<TTDFPLYFVIMSRLCQDYDTIGPEGGSLKS1085
ANK3KNEDLTELLNGMDEELDSPEELGKKRICRI>I<TKDFPQYFAVVSRIKQESNQIGPEGGILSS1156
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

There are currently no reported variants at residue 1110 for ANK2.