Paralogue Annotation for ANK2 residue 1219

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1219
Reference Amino Acid: G - Glycine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 1219

No paralogue variants have been mapped to residue 1219 for ANK2.



ANK2LEPRRRKFHKPITMTIPVPKASSDVMLNGF>G<GDA-PTLRLLCSITGGTTPAQWEDITGTTP1248
ANK1VEPRRRKFHRPIGLRIPLPPSWTDNPRDSG>E<GDT-TSLRLLCSVIGGTDQAQWEDITGTTK1193
ANK3VEPRRRKFHKPITMTIPVPPPSGEGVSNGY>K<GDTTPNLRLLCSITGGTSPAQWEDITGTTP1265
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G1219Rc.3655G>A Putative BenignSIFT: tolerated
Polyphen: probably damaging