Paralogue Annotation for ANK2 residue 1231

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1231
Reference Amino Acid: I - Isoleucine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 1231

No paralogue variants have been mapped to residue 1231 for ANK2.



ANK2MTIPVPKASSDVMLNGFGGDA-PTLRLLCS>I<TGGTTPAQWEDITGTTPLTFVNECVSFTTN1261
ANK1LRIPLPPSWTDNPRDSGEGDT-TSLRLLCS>V<IGGTDQAQWEDITGTTKLVYANECANFTTN1206
ANK3MTIPVPPPSGEGVSNGYKGDTTPNLRLLCS>I<TGGTSPAQWEDITGTTPLTFIKDCVSFTTN1278
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.I1231Lc.3691A>C Putative BenignSIFT:
Polyphen: probably damaging