Paralogue Annotation for ANK2 residue 1247

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1247
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 1247

No paralogue variants have been mapped to residue 1247 for ANK2.



ANK2FGGDA-PTLRLLCSITGGTTPAQWEDITGT>T<PLTFVNECVSFTTNVSARFWLIDCRQIQES1277
ANK1GEGDT-TSLRLLCSVIGGTDQAQWEDITGT>T<KLVYANECANFTTNVSARFWLSDCPRTAEA1222
ANK3YKGDTTPNLRLLCSITGGTSPAQWEDITGT>T<PLTFIKDCVSFTTNVSARFWLADCHQVLET1294
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T1247Mc.3740C>T Putative BenignSIFT: deleterious
Polyphen: probably damaging