Paralogue Annotation for ANK2 residue 1306

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1306
Reference Amino Acid: P - Proline
Protein Domain:


Paralogue Variants mapped to ANK2 residue 1306

No paralogue variants have been mapped to residue 1306 for ANK2.



ANK2ESVTFASQVYREIICVPYMAKFVVFAKSHD>P<IEARLRCFCMTDDKVDKTLEQQENFAEVAR1336
ANK1EAVNFATLLYKELTAVPYMAKFVIFAKMND>P<REGRLRCYCMTDDKVDKTLEQHENFVEVAR1281
ANK3ETVGLATQLYRELICVPYMAKFVVFAKMND>P<VESSLRCFCMTDDKVDKTLEQQENFEEVAR1353
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P1306Lc.3917C>T Putative BenignSIFT: deleterious
Polyphen: possibly damaging