Paralogue Annotation for ANK2 residue 1384

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1384
Reference Amino Acid: V - Valine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 1384

No paralogue variants have been mapped to residue 1384 for ANK2.



ANK2GNLVPLTKSGQHHIFSFFAFKENRLPLFVK>V<RDTTQEPCGRLSFMKEPKSTRGLVHQAICN1414
ANK1GNLVPVKKAAQQRSFHFQSFRENRLAMPVK>V<RDSSREPGGSLSFLRKAMKYEDTQ-HILCH1358
ANK3GNLAPLTKGGQQLVFNFYSFKENRLPFSIK>I<RDTSQEPCGRLSFLKEPKTTKGLPQTAVCN1431
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V1384Ic.4150G>A Putative BenignSIFT: tolerated
Polyphen: benign