No paralogue variants have been mapped to residue 1398 for ANK2.
| ANK2 | FSFFAFKENRLPLFVKVRDTTQEPCGRLSF>M<KEPKSTRGLVHQAICNLNITLPIYTKESES | 1428 |
| ANK1 | FHFQSFRENRLAMPVKVRDSSREPGGSLSF>L<RKAMKYEDTQ-HILCHLNITMPPCAKGSGA | 1372 |
| ANK3 | FNFYSFKENRLPFSIKIRDTSQEPCGRLSF>L<KEPKTTKGLPQTAVCNLNITLPAHKKETES | 1445 |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.M1398T | c.4193T>C | Putative Benign | SIFT: tolerated Polyphen: benign | ||
| p.M1398V | c.4192A>G | Putative Benign | SIFT: Polyphen: |