Paralogue Annotation for ANK2 residue 1404

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1404
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 1404

No paralogue variants have been mapped to residue 1404 for ANK2.



ANK2KENRLPLFVKVRDTTQEPCGRLSFMKEPKS>T<RGLVHQAICNLNITLPIYTKESESDQEQE-1433
ANK1RENRLAMPVKVRDSSREPGGSLSFLRKAMK>Y<EDTQ-HILCHLNITMPPCAKGSGAEDRRR-1377
ANK3KENRLPFSIKIRDTSQEPCGRLSFLKEPKT>T<KGLPQTAVCNLNITLPAHKKETESDQDDEI1451
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T1404Mc.4211C>T Putative BenignSIFT:
Polyphen: possibly damaging
ReportsUnknown Novel genotype-phenotype associations demonstrated by high-throughput sequencing in patients with hypertrophic cardiomyopathy. Heart. 2015 101(4):294-301. doi: 10.1136/heartjnl-2014-306387. 25351510