Paralogue Annotation for ANK2 residue 1430

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1430
Reference Amino Acid: Q - Glutamine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 1430

No paralogue variants have been mapped to residue 1430 for ANK2.



ANK2EPKSTRGLVHQAICNLNITLPIYTKESESD>Q<EQE--------EEIDMTSE--KNDETESTE1450
ANK1KAMKYEDTQ-HILCHLNITMPPCAKGSGAE>D<RRR--------TPTPLALR--YSILSE---1391
ANK3EPKTTKGLPQTAVCNLNITLPAHKKETESD>Q<DDEIEKTDRRQSFASLALRKRYSYLTE--P1475
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Q1430Kc.4288C>A Putative BenignSIFT: tolerated
Polyphen: possibly damaging