Paralogue Annotation for ANK2 residue 1453

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1453
Reference Amino Acid: V - Valine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 1453

No paralogue variants have been mapped to residue 1453 for ANK2.

ANK2	--EEIDMTSE--KNDETESTE-------TS>V<LKS---------------------------	1456
ANK1	--TPTPLALR--YSILSE------------>-<------------------------------	1391
ANK3	RQSFASLALRKRYSYLTE--PGMIERSTGA>T<RSLPTTYSYKPFFSTRPYQSWTTAPITVPG	1515
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.V1453L	c.4357G>C	Benign		rs149678604	SIFT: Polyphen: possibly damaging
p.V1453I	c.4357G>A	Putative Benign			SIFT: Polyphen: