Paralogue Annotation for ANK2 residue 1465

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1465
Reference Amino Acid: L - Leucine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 1465

No paralogue variants have been mapped to residue 1465 for ANK2.

ANK2	----------HLV------------NEVPV>L<----------ASPDLLSEVSEMKQDLIKMT	1485
ANK1	-------------------STP-------->-<------------------------------	1394
ANK3	SSSSSNTPSASPLKSIWSVSTPSPIKSTLG>A<STTSSVKSISDVASPIRSFRTMSSPIKTVV	1585
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.L1465P	c.4394T>C	Putative Benign			SIFT: Polyphen: