Paralogue Annotation for ANK2 residue 1466

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1466
Reference Amino Acid: A - Alanine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 1466

No paralogue variants have been mapped to residue 1466 for ANK2.



ANK2LV------------NEVPVL---------->A<SPDLLSEVSEMKQDLIKMTAILTTDVSDKA1496
ANK1--------STP------------------->-<------------------------------1394
ANK3PLKSIWSVSTPSPIKSTLGASTTSSVKSIS>D<VASPIRSFRTMSSPIKTVVSQSPYN-----1591
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A1466Ec.4397C>A Putative BenignSIFT: deleterious
Polyphen: possibly damaging