No paralogue variants have been mapped to residue 1466 for ANK2.
| ANK2 | LV------------NEVPVL---------->A<SPDLLSEVSEMKQDLIKMTAILTTDVSDKA | 1496 |
| ANK1 | --------STP------------------->-<------------------------------ | 1394 |
| ANK3 | PLKSIWSVSTPSPIKSTLGASTTSSVKSIS>D<VASPIRSFRTMSSPIKTVVSQSPYN----- | 1591 |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.A1466E | c.4397C>A | Putative Benign | SIFT: deleterious Polyphen: possibly damaging |