Paralogue Annotation for ANK2 residue 1467

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1467
Reference Amino Acid: S - Serine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 1467

No paralogue variants have been mapped to residue 1467 for ANK2.



ANK2V------------NEVPVL----------A>S<PDLLSEVSEMKQDLIKMTAILTTDVSDKAG1497
ANK1-------STP-------------------->-<------------------------------1394
ANK3LKSIWSVSTPSPIKSTLGASTTSSVKSISD>V<ASPIRSFRTMSSPIKTVVSQSPYN------1591
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S1467Nc.4400G>A Putative BenignSIFT: deleterious
Polyphen: probably damaging