Paralogue Annotation for ANK2 residue 1544

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1544
Reference Amino Acid: S - Serine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 1544

No paralogue variants have been mapped to residue 1544 for ANK2.

ANK2	--------VKEDLEKVNEILRSGTCTRDES>S<VQSSRSE-----------------------	1551
ANK1	------------------------------>-<------------------------------
ANK3	ASNSTFSSRTSPVTTAGSLLERSSITMTPP>A<SPKSNINMYSSSLPFKSIITSAAPLISSPL	1675
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.S1544R	c.4632T>A	Putative Benign			SIFT: Polyphen: