Paralogue Annotation for ANK2 residue 1588

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1588
Reference Amino Acid: I - Isoleucine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 1588

No paralogue variants have been mapped to residue 1588 for ANK2.



ANK2EWVIVSDEEIEEARQKAPLEITEYPCVEVR>I<DKEIKGKVEKDSTGLVN--YLTDDLNT---1613
ANK1------------------------------>-<------------------------------
ANK3VDVISSAKITMASSLSSPVKQMPGHAEVAL>V<NGSISPLKYPSSSTLINGCKATATLQEKIS1746
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.I1588Vc.4762A>G Putative BenignSIFT: tolerated
Polyphen: benign