Paralogue Annotation for ANK2 residue 1645

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1645
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to ANK2 residue 1645

No paralogue variants have been mapped to residue 1645 for ANK2.



ANK2--LPKEQLQTVQDKAGKKCEALAVGRSSEK>E<GKDIPPDETQSTQKQHKPSLGIKKPVRRKL1675
ANK1------------------------------>-<------------------------------
ANK3NVLPEPALKKLPDSNSFTKSAAALLSPIKT>L<TTETHPQPHFSRTSSPVKSSLFLAPSALKL1889
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E1645Kc.4933G>A Putative BenignSIFT: tolerated
Polyphen: benign
ReportsUnknown Novel genotype-phenotype associations demonstrated by high-throughput sequencing in patients with hypertrophic cardiomyopathy. Heart. 2015 101(4):294-301. doi: 10.1136/heartjnl-2014-306387. 25351510