Paralogue Annotation for ANK2 residue 1677

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1677
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to ANK2 residue 1677

No paralogue variants have been mapped to residue 1677 for ANK2.



ANK2KDIPPDETQSTQKQHKPSLGIKKPVRRKLK>E<KQKQKEEGLQASAEKAELKKGSSEESLGED1707
ANK1------------------------------>-<------------------------------
ANK3TETHPQPHFSRTSSPVKSSLFLAPSALKLS>T<PSSLSSSQEILKDVAEMKEDLMRMTAILQT1921
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E1677Vc.5030A>T Putative BenignSIFT: deleterious
Polyphen: possibly damaging