No paralogue variants have been mapped to residue 1711 for ANK2.
| ANK2 | QKEEGLQASAEKAELKKGSSEESLGEDPGL>A<PEPLPTVKATSPLIEETPIGSIKDKVKALQ | 1741 |
| ANK1 | ------------------------------>-<------------------------------ | |
| ANK3 | LSSSQEILKDVAEMKEDLMRMTAILQTDVP>E<EKPFQPELPKEGRIDDEEPFKIVEKVKEDL | 1955 |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.A1711D | c.5132C>A | Putative Benign | rs147706514 | SIFT: Polyphen: possibly damaging | |
| Reports | Unknown | Novel genotype-phenotype associations demonstrated by high-throughput sequencing in patients with hypertrophic cardiomyopathy. Heart. 2015 101(4):294-301. doi: 10.1136/heartjnl-2014-306387. 25351510 | |||
| p.A1711V | c.5132C>T | Putative Benign | SIFT: Polyphen: | ||
| Reports | Unknown | Novel genotype-phenotype associations demonstrated by high-throughput sequencing in patients with hypertrophic cardiomyopathy. Heart. 2015 101(4):294-301. doi: 10.1136/heartjnl-2014-306387. 25351510 | |||