Paralogue Annotation for ANK2 residue 1743

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1743
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 1743

No paralogue variants have been mapped to residue 1743 for ANK2.



ANK2EPLPTVKATSPLIEETPIGSIKDKVKALQK>R<VEDEQK------------------------1749
ANK1------------------------------>-<------------------------------
ANK3KPFQPELPKEGRIDDEEPFKIVEKVKEDLV>K<VSEILKKDVCVDNKGSPKSPKSDKGHSPED1987
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R1743Qc.5228G>A Putative Benignrs150207892SIFT:
Polyphen: possibly damaging