Paralogue Annotation for ANK2 residue 1750

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1750
Reference Amino Acid: G - Glycine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 1750

No paralogue variants have been mapped to residue 1750 for ANK2.

ANK2	------------------------------>G<------------------------------	1750
ANK1	------------------------------>-<------------------------------
ANK3	NKGSPKSPKSDKGHSPEDDWIEFSSEEIRE>A<RQQAAASQSPSLPERVQVKAKAASEKDYNL	2030
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.G1750D	c.5249G>A	Putative Benign			SIFT: Polyphen: