Paralogue Annotation for ANK2 residue 1751

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1751
Reference Amino Acid: R - Arginine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 1751

No paralogue variants have been mapped to residue 1751 for ANK2.

ANK2	------------------------------>R<SKLPIRVKGKEDVPKKTTHRPHPAASPSLK	1781
ANK1	------------------------------>-<------------------------------
ANK3	PERVQVKAKAASEKDYNLTKVIDYLTNDIG>S<SSLTNLKYKFEDAKKDGEERQKRVLKPAIA	2073
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.R1751Q	c.5252G>A	Putative Benign			SIFT: Polyphen:
p.R1751P	c.5252G>C	Putative Benign			SIFT: Polyphen: