Paralogue Annotation for ANK2 residue 1757

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1757
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 1757

No paralogue variants have been mapped to residue 1757 for ANK2.



ANK2------------------------RSKLPI>R<VKGKEDVPKKTTHRPHPAASPSLKSERHAP1787
ANK1------------------------------>-<------------------------------
ANK3KAKAASEKDYNLTKVIDYLTNDIGSSSLTN>L<KYKFEDAKKDGEERQKRVLKPAIALQEHKL2079
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R1757Kc.5270G>A Putative BenignSIFT:
Polyphen: benign