No paralogue variants have been mapped to residue 1776 for ANK2.
| ANK2 | -----RSKLPIRVKGKEDVPKKTTHRPHPA>A<SPSLKSERHAPGSPSPKTERHSTLSS---- | 1802 |
| ANK1 | ------------------------------>-<------------------------------ | |
| ANK3 | TNDIGSSSLTNLKYKFEDAKKDGEERQKRV>L<KPAIALQEHKLKMPPASMRTSTSEKELCKM | 2098 |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.A1776V | c.5327C>T | Putative Benign | SIFT: tolerated Polyphen: benign |