Paralogue Annotation for ANK2 residue 1776

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1776
Reference Amino Acid: A - Alanine
Protein Domain: Repeat-rich region


Paralogue Variants mapped to ANK2 residue 1776

No paralogue variants have been mapped to residue 1776 for ANK2.



ANK2-----RSKLPIRVKGKEDVPKKTTHRPHPA>A<SPSLKSERHAPGSPSPKTERHSTLSS----1802
ANK1------------------------------>-<------------------------------
ANK3TNDIGSSSLTNLKYKFEDAKKDGEERQKRV>L<KPAIALQEHKLKMPPASMRTSTSEKELCKM2098
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A1776Vc.5327C>T Putative BenignSIFT: tolerated
Polyphen: benign