Paralogue Annotation for ANK2 residue 1789

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1789
Reference Amino Acid: S - Serine
Protein Domain: Repeat-rich region


Paralogue Variants mapped to ANK2 residue 1789

No paralogue variants have been mapped to residue 1789 for ANK2.



ANK2KGKEDVPKKTTHRPHPAASPSLKSERHAPG>S<PSPKTERHSTLSS-----------------1802
ANK1------------------------------>-<------------------------------
ANK3YKFEDAKKDGEERQKRVLKPAIALQEHKLK>M<PPASMRTSTSEKELCKMADSFFGTDTILES2111
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S1789Fc.5366C>T Putative BenignSIFT:
Polyphen: benign