Paralogue Annotation for ANK2 residue 1818

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1818
Reference Amino Acid: T - Threonine
Protein Domain: Repeat-rich region


Paralogue Variants mapped to ANK2 residue 1818

No paralogue variants have been mapped to residue 1818 for ANK2.



ANK2---------------SAKTERHPPVSPSSK>T<EKHSPVSPSAKTERHSPASSSSKTEKHSPV1848
ANK1------------------------------>-<------------------------------
ANK3SFFGTDTILESPDDFSQHDQDKSPLSDSGF>E<TRSEKTPSAPQSAESTGPKPLFHEVPIPPV2161
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T1818Ic.5453C>T Putative BenignSIFT: tolerated
Polyphen: possibly damaging