No paralogue variants have been mapped to residue 1820 for ANK2.
| ANK2 | -------------SAKTERHPPVSPSSKTE>K<HSPVSPSAKTERHSPASSSSKTEKHSPVSP | 1850 |
| ANK1 | ------------------------------>-<------------------------------ | |
| ANK3 | FGTDTILESPDDFSQHDQDKSPLSDSGFET>R<SEKTPSAPQSAESTGPKPLFHEVPIPPVIT | 2163 |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.K1820E | c.5458A>G | Putative Benign | SIFT: Polyphen: |