No paralogue variants have been mapped to residue 1823 for ANK2.
| ANK2 | ----------SAKTERHPPVSPSSKTEKHS>P<VSPSAKTERHSPASSSSKTEKHSPVSPSTK | 1853 |
| ANK1 | ------------------------------>-<------------------------------ | |
| ANK3 | DTILESPDDFSQHDQDKSPLSDSGFETRSE>K<TPSAPQSAESTGPKPLFHEVPIPPVITETR | 2166 |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.P1823L | c.5468C>T | Putative Benign | SIFT: Polyphen: |