Paralogue Annotation for ANK2 residue 1851

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1851
Reference Amino Acid: S - Serine
Protein Domain: Repeat-rich region


Paralogue Variants mapped to ANK2 residue 1851

No paralogue variants have been mapped to residue 1851 for ANK2.



ANK2HSPVSPSAKTERHSPASSSSKTEKHSPVSP>S<TKTERHSPVSSTKTERHPPVSPSGKTDKRP1881
ANK1------------------------------>-<------------------------------
ANK3SEKTPSAPQSAESTGPKPLFHEVPIPPVIT>E<TRTEVVHVIRSYDPSAGDVPQTQPEEPVSP2194
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S1851Lc.5552C>T Putative BenignSIFT:
Polyphen: possibly damaging
ReportsUnknown Novel genotype-phenotype associations demonstrated by high-throughput sequencing in patients with hypertrophic cardiomyopathy. Heart. 2015 101(4):294-301. doi: 10.1136/heartjnl-2014-306387. 25351510