Paralogue Annotation for ANK2 residue 1859

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1859
Reference Amino Acid: P - Proline
Protein Domain: Repeat-rich region


Paralogue Variants mapped to ANK2 residue 1859

No paralogue variants have been mapped to residue 1859 for ANK2.



ANK2KTERHSPASSSSKTEKHSPVSPSTKTERHS>P<VSSTKTERHPPVSPSGKTDKRPPVSPSGR-1888
ANK1------------------------------>-<------------------------------
ANK3QSAESTGPKPLFHEVPIPPVITETRTEVVH>V<IRSYDPSAGDVPQTQPEEPVSPKPSPTFME2202
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P1859Sc.5575C>T Putative Benignrs374602818SIFT: tolerated
Polyphen: benign