No paralogue variants have been mapped to residue 1878 for ANK2.
| ANK2 | VSPSTKTERHSPVSSTKTERHPPVSPSGKT>D<KRPPVSPSGR-TEKHPPVSPG-RTEKRLPV | 1906 |
| ANK1 | ------------------------------>-<------------------------------ | |
| ANK3 | VITETRTEVVHVIRSYDPSAGDVPQTQPEE>P<VSPKPSPTFMELEPKPTTSSIKEKVKAFQM | 2221 |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.D1878N | c.5632G>A | Putative Benign | SIFT: Polyphen: |