Paralogue Annotation for ANK2 residue 1880

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1880
Reference Amino Acid: R - Arginine
Protein Domain: Repeat-rich region


Paralogue Variants mapped to ANK2 residue 1880

No paralogue variants have been mapped to residue 1880 for ANK2.



ANK2PSTKTERHSPVSSTKTERHPPVSPSGKTDK>R<PPVSPSGR-TEKHPPVSPG-RTEKRLPVSP1908
ANK1------------------------------>-<------------------------------
ANK3TETRTEVVHVIRSYDPSAGDVPQTQPEEPV>S<PKPSPTFMELEPKPTTSSIKEKVKAFQMKA2223
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R1880Cc.5638C>T Putative Benignrs147547363SIFT:
Polyphen: probably damaging