Paralogue Annotation for ANK2 residue 1887

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1887
Reference Amino Acid: G - Glycine
Protein Domain: Repeat-rich region


Paralogue Variants mapped to ANK2 residue 1887

No paralogue variants have been mapped to residue 1887 for ANK2.



ANK2HSPVSSTKTERHPPVSPSGKTDKRPPVSPS>G<R-TEKHPPVSPG-RTEKRLPVSPSGRTDKH1915
ANK1------------------------------>-<------------------------------
ANK3VHVIRSYDPSAGDVPQTQPEEPVSPKPSPT>F<MELEPKPTTSSIKEKVKAFQMKASSEEDDH2230
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G1887Rc.5659G>A Putative Benignrs140189724SIFT:
Polyphen: probably damaging