No paralogue variants have been mapped to residue 1890 for ANK2.
| ANK2 | SSTKTERHPPVSPSGKTDKRPPVSPSGR-T>E<KHPPVSPG-RTEKRLPVSPSGRTDKHQPVS | 1919 |
| ANK1 | ------------------------------>-<------------------------------ | |
| ANK3 | RSYDPSAGDVPQTQPEEPVSPKPSPTFMEL>E<PKPTTSSIKEKVKAFQMKASSEEDDHNRVL | 2234 |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.E1890K | c.5668G>A | Benign | rs201599166 | SIFT: deleterious Polyphen: benign | |
| p.E1890G | c.5669A>G | Putative Benign | SIFT: Polyphen: |