No paralogue variants have been mapped to residue 1896 for ANK2.
| ANK2 | RHPPVSPSGKTDKRPPVSPSGR-TEKHPPV>S<PG-RTEKRLPVSPSGRTDKHQPVSTAG-KT | 1924 |
| ANK1 | ------------------------------>-<------------------------------ | |
| ANK3 | AGDVPQTQPEEPVSPKPSPTFMELEPKPTT>S<SIKEKVKAFQMKASSEEDDHNRVLSKGMRV | 2240 |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.S1896L | c.5687C>T | Putative Benign | SIFT: Polyphen: |