No paralogue variants have been mapped to residue 1906 for ANK2.
| ANK2 | DKRPPVSPSGR-TEKHPPVSPG-RTEKRLP>V<SPSGRTDKHQPVSTAG-KTEKHLPVSPSGK | 1935 |
| ANK1 | ------------------------------>-<------------------------------ | |
| ANK3 | PVSPKPSPTFMELEPKPTTSSIKEKVKAFQ>M<KASSEEDDHNRVLSKGMRVKEETHITTTTR | 2251 |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.V1906L | c.5716G>C | Putative Benign | SIFT: Polyphen: |