Paralogue Annotation for ANK2 residue 1913

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1913
Reference Amino Acid: D - Aspartate
Protein Domain: Repeat-rich region


Paralogue Variants mapped to ANK2 residue 1913

No paralogue variants have been mapped to residue 1913 for ANK2.



ANK2PSGR-TEKHPPVSPG-RTEKRLPVSPSGRT>D<KHQPVSTAG-KTEKHLPVSPSGKTEKQPPV1942
ANK1------------------------------>-<------------------------------
ANK3PTFMELEPKPTTSSIKEKVKAFQMKASSEE>D<DHNRVLSKGMRVKEETHITTTTRMVYHSPP2258
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D1913Yc.5737G>T Putative BenignSIFT: tolerated
Polyphen: benign