Paralogue Annotation for ANK2 residue 1936

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1936
Reference Amino Acid: T - Threonine
Protein Domain: Repeat-rich region


Paralogue Variants mapped to ANK2 residue 1936

No paralogue variants have been mapped to residue 1936 for ANK2.



ANK2SPSGRTDKHQPVSTAG-KTEKHLPVSPSGK>T<EKQPPVSPTSKTERIEETMSVRELMKAFQS1966
ANK1------------------------------>-<------------------------------
ANK3KASSEEDDHNRVLSKGMRVKEETHITTTTR>M<VYHSPPGGEGASERIEETMSVHDIMKAFQS2282
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T1936Ic.5807C>T Putative BenignSIFT:
Polyphen: possibly damaging