No paralogue variants have been mapped to residue 1936 for ANK2.
| ANK2 | SPSGRTDKHQPVSTAG-KTEKHLPVSPSGK>T<EKQPPVSPTSKTERIEETMSVRELMKAFQS | 1966 |
| ANK1 | ------------------------------>-<------------------------------ | |
| ANK3 | KASSEEDDHNRVLSKGMRVKEETHITTTTR>M<VYHSPPGGEGASERIEETMSVHDIMKAFQS | 2282 |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.T1936I | c.5807C>T | Putative Benign | rs148760530 | SIFT: Polyphen: possibly damaging |