Paralogue Annotation for ANK2 residue 1938

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1938
Reference Amino Acid: K - Lysine
Protein Domain: Repeat-rich region


Paralogue Variants mapped to ANK2 residue 1938

No paralogue variants have been mapped to residue 1938 for ANK2.



ANK2SGRTDKHQPVSTAG-KTEKHLPVSPSGKTE>K<QPPVSPTSKTERIEETMSVRELMKAFQSGQ1968
ANK1------------------------------>-<------------------------------
ANK3SSEEDDHNRVLSKGMRVKEETHITTTTRMV>Y<HSPPGGEGASERIEETMSVHDIMKAFQSGR2284
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.K1938Ec.5812A>G Putative BenignSIFT: tolerated
Polyphen: possibly damaging