Paralogue Annotation for ANK2 residue 1946

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1946
Reference Amino Acid: S - Serine
Protein Domain: Repeat-rich region


Paralogue Variants mapped to ANK2 residue 1946

No paralogue variants have been mapped to residue 1946 for ANK2.



ANK2PVSTAG-KTEKHLPVSPSGKTEKQPPVSPT>S<KTERIEETMSVRELMKAFQSGQDPSKHKTG1976
ANK1------------------------------>-<------------------------------
ANK3RVLSKGMRVKEETHITTTTRMVYHSPPGGE>G<ASERIEETMSVHDIMKAFQSGRDPSKELAG2292
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S1946Lc.5837C>T Putative BenignSIFT: tolerated
Polyphen: possibly damaging