Paralogue Annotation for ANK2 residue 1950

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 1950
Reference Amino Acid: R - Arginine
Protein Domain: Repeat-rich region


Paralogue Variants mapped to ANK2 residue 1950

No paralogue variants have been mapped to residue 1950 for ANK2.



ANK2AG-KTEKHLPVSPSGKTEKQPPVSPTSKTE>R<IEETMSVRELMKAFQSGQDPSKHKTGLFEH1980
ANK1------------------------------>-<------------------------------
ANK3KGMRVKEETHITTTTRMVYHSPPGGEGASE>R<IEETMSVHDIMKAFQSGRDPSKELAGLFEH2296
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R1950Gc.5848A>G Putative BenignSIFT: deleterious
Polyphen: probably damaging