No paralogue variants have been mapped to residue 1951 for ANK2.
| ANK2 | G-KTEKHLPVSPSGKTEKQPPVSPTSKTER>I<EETMSVRELMKAFQSGQDPSKHKTGLFEHK | 1981 |
| ANK1 | ------------------------------>-<------------------------------ | |
| ANK3 | GMRVKEETHITTTTRMVYHSPPGGEGASER>I<EETMSVHDIMKAFQSGRDPSKELAGLFEHK | 2297 |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.I1951T | c.5852T>C | Putative Benign | SIFT: Polyphen: |