No paralogue variants have been mapped to residue 1961 for ANK2.
| ANK2 | SPSGKTEKQPPVSPTSKTERIEETMSVREL>M<KAFQSGQDPSKHKTGLFEHKSAKQKQPQEK | 1991 |
| ANK1 | ------------------------------>-<------------------------------ | |
| ANK3 | TTTTRMVYHSPPGGEGASERIEETMSVHDI>M<KAFQSGRDPSKELAGLFEHKSAVSPDVHKS | 2307 |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.M1961V | c.5881A>G | Putative Benign | SIFT: Polyphen: |