No paralogue variants have been mapped to residue 1985 for ANK2.
| ANK2 | MSVRELMKAFQSGQDPSKHKTGLFEHKSAK>Q<KQPQEKGKVR-------------------- | 1995 |
| ANK1 | ------------------------------>-<------------------------------ | |
| ANK3 | MSVHDIMKAFQSGRDPSKELAGLFEHKSAV>S<PDVHKSAAETSAQHAEKDNQMKPKLERIIE | 2331 |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.Q1985K | c.5953C>A | Putative Benign | rs76778190 | SIFT: tolerated Polyphen: benign |