Paralogue Annotation for ANK2 residue 2000

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2000
Reference Amino Acid: K - Lysine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2000

No paralogue variants have been mapped to residue 2000 for ANK2.

ANK2	EKGKVR--------------------VEKE>K<GPILT-----QREAQK-------TENQTI-	2017
ANK1	------------------------------>-<------------------------------
ANK3	KSAAETSAQHAEKDNQMKPKLERIIEVHIE>K<GNQAEPTEVIIRETKKHPEKEMYVYQKDLS	2366
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.K2000E	c.5998A>G	Putative Benign			SIFT: Polyphen: