Paralogue Annotation for ANK2 residue 2001

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2001
Reference Amino Acid: G - Glycine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2001

No paralogue variants have been mapped to residue 2001 for ANK2.

ANK2	KGKVR--------------------VEKEK>G<PILT-----QREAQK-------TENQTI--	2017
ANK1	------------------------------>-<------------------------------
ANK3	SAAETSAQHAEKDNQMKPKLERIIEVHIEK>G<NQAEPTEVIIRETKKHPEKEMYVYQKDLSR	2367
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.G2001R	c.6001G>A	Putative Benign			SIFT: Polyphen:
p.G2001E	c.6002G>A	Putative Benign			SIFT: Polyphen: