Paralogue Annotation for ANK2 residue 2002

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2002
Reference Amino Acid: P - Proline
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2002

No paralogue variants have been mapped to residue 2002 for ANK2.

ANK2	GKVR--------------------VEKEKG>P<ILT-----QREAQK-------TENQTI---	2017
ANK1	------------------------------>-<------------------------------
ANK3	AAETSAQHAEKDNQMKPKLERIIEVHIEKG>N<QAEPTEVIIRETKKHPEKEMYVYQKDLSRG	2368
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.P2002L	c.6005C>T	Putative Benign		rs151268188	SIFT: Polyphen: benign