Paralogue Annotation for ANK2 residue 2003

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2003
Reference Amino Acid: I - Isoleucine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2003

No paralogue variants have been mapped to residue 2003 for ANK2.

ANK2	KVR--------------------VEKEKGP>I<LT-----QREAQK-------TENQTI----	2017
ANK1	------------------------------>-<------------------------------
ANK3	AETSAQHAEKDNQMKPKLERIIEVHIEKGN>Q<AEPTEVIIRETKKHPEKEMYVYQKDLSRGD	2369
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.I2003M	c.6009A>G	Putative Benign			SIFT: Polyphen: