Paralogue Annotation for ANK2 residue 2007

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2007
Reference Amino Acid: R - Arginine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2007

No paralogue variants have been mapped to residue 2007 for ANK2.

ANK2	--------------VEKEKGPILT-----Q>R<EAQK-------TENQTI-------------	2017
ANK1	------------------------------>-<------------------------------
ANK3	KDNQMKPKLERIIEVHIEKGNQAEPTEVII>R<ETKKHPEKEMYVYQKDLSRGDINLKDFLPE	2378
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.R2007T	c.6020G>C	Putative Benign		rs140462708	SIFT: Polyphen: benign