Paralogue Annotation for ANK2 residue 2013

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2013
Reference Amino Acid: E - Glutamate
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2013

No paralogue variants have been mapped to residue 2013 for ANK2.

ANK2	-VEKEKGPILT-----QREAQK-------T>E<NQTI----------------------KRGQ	2021
ANK1	------------------------------>-<------------------------------
ANK3	EVHIEKGNQAEPTEVIIRETKKHPEKEMYV>Y<QKDLSRGDINLKDFLPEKHDAFPCSEEQGQ	2391
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.E2013G	c.6038A>G	Putative Benign		rs375151747	SIFT: tolerated Polyphen: benign