Paralogue Annotation for ANK2 residue 2015

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2015
Reference Amino Acid: Q - Glutamine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2015

No paralogue variants have been mapped to residue 2015 for ANK2.

ANK2	EKEKGPILT-----QREAQK-------TEN>Q<TI----------------------KRGQRL	2023
ANK1	------------------------------>-<------------------------------
ANK3	HIEKGNQAEPTEVIIRETKKHPEKEMYVYQ>K<DLSRGDINLKDFLPEKHDAFPCSEEQGQQE	2393
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.Q2015R	c.6044A>G	Putative Benign		rs201628725	SIFT: tolerated Polyphen: benign
p.Q2015E	c.6043C>G	Putative Benign			SIFT: Polyphen: